<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1833 CA24787 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 D4T 87
3 3TC+AZT+IDV 42
4 3TC+D4T+IDV 26
5 DDC+NFV+NVP 47
6 DDC+RTV+SQV 31
7 ABC+EFV+RTV+SQV 38
8 APV+D4T+EFV+RTV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54M, V82A, I84V L33F L10I, T12S, L19V, L63T, A71V, I72T, I93L  
>CA24787| codons 1-99
PQITLWQRPIVSIKIGGQVKEALLDTGADDTVFEEMNLPGRWKPKLIVGIGGFMKVRQYD
QITIEICGHKVTGTVLVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, L210W, T215Y   K101E, Y181C, G190A A98G K20R, T39E, E44D, V118I, K122E, I135T, G196E, E203K, R211K, A272S, V276T, K277R, Q278E, L283I, I293V, E297KR, L303T E302R
>CA24786| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICEELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIEQHRTKIKELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKTRELCKLIRGTKALTEVVPLTKEAE
LRT

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009