<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9985 CA24775 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D E35D, M36I, I62V, L63P, A71X G16GV
>CA24775| codons 14-99
KIVGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYDQVPIEICGHKXIG
TVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, V35IT, T69TA, R83K, K122E, I135V, E138A, K166R, Q197L, I202IV, F214FL, V245E, E248D, D250DN, A272P, V276I, L283LI, A288S  
>CA24774| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSAKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGLHRTKVEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKNSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKSLTEVIPLTEEAE

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009