<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
6 6 Estonia 2010 HIV1 CRF06_cpx Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, G17E, L19V, K20I, E35D, M36I, R41K, L63H, I64V, H69K, L89LM, Q92K  
>6| codons 6-99
WQRPLVTVRVGEQVIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIHVE
ICGKKAIGTVLVGPTPVNIIGRNMLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, V60I, K122KE, I142IT, K166KR, D177E, I178M, T200E, Q207E, R211K  
>6| codons 1-241
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHREKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
V

References
Author Title Citation
Avi, R Transmitted drug resistance is still low in newly diagnosed human immunodeficiency virus type 1 CRF06_cpx-infected patients in Estonia in 2010. ARHR, 2013