<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1431 CA24759 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 182
2 3TC+AZT+SQV 57
3 D4T+NFV+NVP 34
4 3TC+D4T+NFV 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M L10F, I84L E35D, M36V, N37E, I62V, L63P, I64L  
>CA24759| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDVELPGRWKPKLIGGIGGFIKVRQYD
QVPLEICGHKAIGTVLVGPTPVNLIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, L210W, T215Y       K43E, K101KQ, V118I, T131X, P133X, I135V, I142V, K166R, R211K, V245M  
>CA24758| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFXIXSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005