<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA639 CA24751 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+ DDC 13
3 AZT+ DDI 34
4 3TC+ AZT 21
5 3TC+ AZT+ D4T 13
6 3TC+ AZT+ SQV 17
7 3TC+ D4T+ IDV 69
8 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48V, I54T, V82A K43T L10I, G16A, K20R, E35D, M36I, L63P, A71V, I93L  
>CA24751| codons 1-99
PQITLWQRPIVTIKIAGQLREALLDTGADDTVLEDINLPGRWTPKIIVGIGGFTKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, L210W, T215Y       E44ED, K104KN, V118VI, D121DY, K122E, I135V, S162CG, K166KN, T200A, Q207QE, R211K, A272P, K277R  
>CA24750| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTNILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVR

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005