<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9977 CA24737 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 3TC+AZT 31
3 3TC+AZT+IDV 262

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M   M36L, I62V, L63P, I66L, A71V, I72V  
>CA24737| codons 14-99
KIGGQLKEALLDTGADDTILEELNLPGRWKPKIIGGIGGFIKVRQYDQVPIELCGHKVVG
TVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219E     V21I, V35I, T39TA, E44D, S68G, R83K, A98S, K122E, D218E, I293V, E297K, R356K, G359S, A400T, E404D, D460N, V467I, V496I, A538S  
>CA24736| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPV
FAIKKKNGTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPEEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIHLALQDSGLEVNIITDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPSHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005