<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
13975-07 13975-07 Slovenia 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14KR, I15V, K20I, M36T, R41K, L63P, H69K, L89I, F99L  
>13975-07| codons 6-99
WQRPIVTVRVGGQLIEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYDQIPIE
ICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, V60I, K122E, D123N, I135L, S162A, K173I, Q174K, D177E, Q197QL, T200A, Q207E, R211K  
>13975-07| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGLHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Lunar, MM Prevalence of HIV type 1 transmitted drug resistance in Slovenia: 2005-2010. ARHR, 2013