<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
6391-10 6391-10 Slovenia 2010 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20I, E35Q, M36I, N37D, R41K, L63LP, C67E, H69K, K70KR, V82I, L89M  
>6391-10| codons 6-99
WQRPIVTVRIGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVRQYDQIPIE
IEGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, K122E, D123S, I142IMT, K166KR, E169ED, F171FY, K173AT, Q174KR, D177E, I178M, G196D, T200A, E204Q, Q207D, R211K  
>6391-10| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILDPYRTRNPEMVI
YQYMDDLYVGSDLEIDQHRAKIEQLRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Lunar, MM Prevalence of HIV type 1 transmitted drug resistance in Slovenia: 2005-2010. ARHR, 2013