<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7888 CA24723 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 DDI+DLV 39
3 AZT 83
4 3TC+D4T+NFV 166
5 None 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, E34ED, E35ED, M36X, R41K, L63P, I64V, T74S, V77I  
>CA24723| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLDDXNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGSVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39TA, R83RK, I142V, K166R, G196E, V245E, K277R, P294T, E297K  
>CA24722| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVITLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005