<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 83
2 3TC+AZT 31
3 3TC+AZT+IDV 44
4 D4T+DDI+IDV 148
5 D4T+DDI+IDV+RTV 26
6 D4T+DDI+IDV 39
7 None 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       P4Q, E6ED, K43Q, V60I, V118I, I142IV, I178IM, R211T, V245K, A272P, K277R, T286A, Q334V, M357T, A360V, A376C, T377S, K390R, E413D, V458I, T470A, H483N, K512R, S519N, K527N, K530R, A554N, K558R  
>CA23629| codons 1-560
PISQIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWTWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGVGQWTYQIYQEPFKNLKTGKYARTRGV
HTNDVKQLTEAVQKICSESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPDWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYITDRGRQKVVSLADTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLINKERVYLAWVPAHK
GIGGNEQVDKLVSNGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L10FI, K43KT, G73GS I15IV, Q18QH, L19LI, N37S, I62V, L63P, A71V, V77VI  
>CA23630| codons 1-99
PQITLWQRPFVTIKVGGHIKEALLDTGADDTVLEEMSLPGRWTPKLIGGIGGFVKVRQYD
QVPIEICGHKVISTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005