<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT+DDI 22
2 None 74
3 3TC+AZT 22
4 3TC+AZT+IDV 92
5 3TC+AZT+NFV 197

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y       A33V, E40F, I178M, G196E, T200A, E203K, Q207K, R211A, K277R, I293V, D324N, Q334L, M357T, R358K, V458I, D460N, R461K, V467I, K512R, S519N  
>CA24437| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKVLVEICTFLEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIEQHRAKIKELRKHLWAWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKNLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYITNKGRQKVISLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, N37E, L63P, I64IV, T74K, V77I, I93L  
>CA24438| codons 1-99
PQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGKVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005