<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 230
2 AZT+DDI 9
3 3TC+D4T 90
4 D4T+DDI+NFV 132
5 3TC+ABC+APV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184I, L210W, T215Y D67G, K219R   F227FL T39TP, K43KN, E44D, S48SP, V60I, V118I, K122E, D123E, I135T, I142V, G196E, E203K, Q207E, H208Y, R211K, K223E, V245K, A272P, M357T, I375V, K390R, A400T, V435I, V458I, L469I, S519N, K527Q, A554S, K558R  
>CA23659| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICPELENDGKIPKIGPENPYNTPI
FAIKKKGSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIEQHRTKIKELREYLWKWGFYTPDRKHQEEPPLLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKVATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYITDRGRQKVVSITDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIQKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73GS L10I, I13V, Q18QH, K20T, L63LP, I64V, C67LW, V77I, V82VI  
>CA23660| codons 1-99
PQITLWQRPIVTVKIGGHLTEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEILGHKAISTVLIGPTPINIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005