<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 34

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348I     K32N, V35I, I135R, S162C, R211K, A272P, K277R, I293V, E312G, V317G, I329V, Q334E, M357T, K366R, A376S, T377S, E399D, A400T, E404D, V435A, D460N, R461K, S468T, H483Y E300E_E
>CA23968| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKGPVHGGYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKILKTGKYARTRGA
HTNDVRQLTEAVQKISSESIVIWGKTPKFKLPIQKETWDTWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI   N37S, P39S, L63P, I64V, V77I  
>CA23969| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLSGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009