<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1872 CA24705 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 65
2 AZT 39
3 3TC+AZT 22
4 3TC+AZT+IDV 87
5 NFV+NVP+SQV 22
6 D4T+DDI+RTV+SQV 39
7 ABC+APV+D4T+DDI 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, V82A L24I, F53FL L10I, L63A, I64V  
>CA24705| codons 1-98
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGLVKVRQYD
QIAVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KR K103N   K20R, K43N, V60VI, K122E, E169D, V179VI, G196GE, R211RK, D237DN, A272P, K277R, Q278QH, L283I, I293V, E297K  
>CA24704| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDRKHQKEPPFLWMGYELHPNKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLIRGTKALTEVVPLTKEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005