<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V A62V, D67G, K219KE K103N, G190S   A98S, K122E, A158S, I178M, Q197E, V245M, D250E, A272P, T286A, E297R  
>MK81w36| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKRKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVSSDLEIGEHRTKIEELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTREAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12R, L19I, E35D, M36I, R41K, I62V, L63LP, I64IV, K70R  
>MK81w36| codons 1-99
PQITLWQRPLVRIKIGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPVEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Mollan, K HIV-1 amino acid changes among participants with virologic failure: associations with first-line efavirenz or atazanavir plus ritonavir and disease status. J Infect Dis, 2012