<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+EFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, L74LV, Y115F, M184V   K103N, Y181YC, G190A   K22KR, V35M, V118I, K122E, F214L, P243H, V245Q, A272S Q151QH
>MK40w16| codons 1-305
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPHGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQHIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, L63A  
>MK40w16| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Mollan, K HIV-1 amino acid changes among participants with virologic failure: associations with first-line efavirenz or atazanavir plus ritonavir and disease status. J Infect Dis, 2012