<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1866 CA24677 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 64
2 AZT+DDC 17
3 AZT 34
4 AZT+IDV 17
5 IDV+DDI 39
6 3TC+D4T+NVP 58
7 D4T+IDV+RTV 29
8 D4T+IDV+3TC+RTV 121

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73T L10I, K20I, K55R, R57K, L63P, A71IV, I72E, I93L  
>CA24677| codons 1-98
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVKQYD
QIPIEICGHKVETTVLVGPTPVNVIGRNLMTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K43N, E44D, W88C, V118I, K122E, G196E, E203K, Q207E, R211K, A272P, V276T, E297K, I309L, I329V, G333D, Q334N, G359S, A360T, A371V, E399D, A400T, V435A, D460N, R461K, V467I, L469V, H483Y, L491S, Q524E  
>CA24676| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTKQLCKLLRGTKALTEVIPLTKEAE
LELAENRELLKEPVHGVYYDPSKDLIAEVQKQDNGQWTYQIYQEPFKNLKTGKYARMRST
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTNKGRQKVISVTDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005