<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9964 CA24667 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 AZT+DDC 35
3 AZT+DDC+IDV 211

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, L90M   I13L, I15V, K20I, E35D, M36I, N37T, K55KR, R57K, I62V, L63P, A71T, I85V  
>CA24667| codons 1-98
PQITLWQRPLVTLKVGGQLIEALLDTGADDTVLEDITLPGRWKPKIIGGIGGFIRVKQYD
QVPIEICGHKTIGTVLVGPTPTNIVGRNLMTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219Q     V118I, K122E, I135T, F214L, L228H  
>CA24666| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEA

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009