<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5205 CA24665 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+IDV 45
2 D4T+IDV+NVP 77
3 ABC+AZT+NFV 19
4 ABC+DDC+NFV 8
5 ABC+DDI+RTV+SQV 103

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S, L90M Q58QE L10I, I13V, K20I, L63P, A71T, I93L  
>CA24665| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYD
QIPIEICGHKTIGTVLVGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215Y K219E K101E, Y181C, G190A   K20R, T165I, T200A, R211K, V245VE, K275Q, K277R, T286A, E291D E302D
>CA24664| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRAKIEELRQHLLKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIQVRQLCKLLRGAKALTDVIPLTEEAE
LD

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009