<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1468 CA24655 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 178
2 3TC+Unknown 122
3 NVP+Unknown 31
4 3TC+D4T+DDI+RTV+SQV 4
5 3TC+DDI+RTV+SQV 26
6 3TC+D4T+DDI+RTV+SQV 5
7 3TC+D4T+RTV+SQV 60
8 3TC+APV+D4T 31
9 3TC+D4T+LPV+NVP 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, M184V, L210W, T215Y   Y181C V108I V21I, T69S, R83K, T139M, S162A, D177E, R211K V254VD
>CA24655| codons 1-256
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKIVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTDND

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, R20RK, E87ED, T124A, T125A, V150VI, K173R, K211Q  
>CA158560| codons 1-288
FLDGIDKAQEEHEKYHNNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEADVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGIVESMNKELKKIIGQVRDQAEHLRTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTQELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005