<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+EFV 29
2 None 2
3 3TC+ABC+ATV+RTV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15IV, K20KR, L33LV, M36MI, I62V, L63P, I72IV, L89M  
>MK212w53| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADDTVVEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, K102Q, K103R, K122KE, S163ST, T165I, K166KT, T200TA, I202V, F214L, E248D, A272P, K277R, A288S, E297K  
>MK212w53| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMITILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKVEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEVIPLTKEA

References
Author Title Citation
Mollan, K HIV-1 amino acid changes among participants with virologic failure: associations with first-line efavirenz or atazanavir plus ritonavir and disease status. J Infect Dis, 2012