<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6437 CA24639 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 108
2 3TC+AZT+SQV 34
3 DDC+DLV+NFV 134
4 ABC+D4T+IDV+RTV 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y V75M, K219N K101E, Y181C   K11KT, K43N, E44D, V118I, D123E, D177E, E203D, Q207E, H208Y, R211K, L228LR, A272P, I293V  
>CA24639| codons 1-300
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIDELREYLWKWGFYTPDNKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10I, L24F, N37C, K45R, K55R, R57K, L63P, A71V, I72IT, V77I, I93L  
>CA24640| codons 1-99
PQITLWQRPIVTIKIGGQLKEALFDTGADDTVLEEMCLPGRWKPRIIGGIGGFIRVKQYD
QIPIEICGHKVTTTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005