<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+ATV+RTV 19
2 3TC+ABC+EFV 49

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75I K103N V108I V35T, K64KR, D123E, I132L, S162C, K173A, Q174R, D177E, I178L, T200A, Q207G, R211K, V245Q, E248D, A272P, K275R, K277R, Q278H, T286A, A288T, E291D, V292I, I293V  
>MK180w68| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRARNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIRVRHLCKLLRGAKTLTDIVPLTEEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  Q58E L19V, K20R, E35D, M36I, R41K, R57K, D60E, Q61E, L63Q, C67E, H69K, L89M  
>MK180w68| codons 1-99
PQITLWQRPLVTIKIGGQVREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKEYE
EIQIEIEGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Mollan, K HIV-1 amino acid changes among participants with virologic failure: associations with first-line efavirenz or atazanavir plus ritonavir and disease status. J Infect Dis, 2012