<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5052 CA24634 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 82
2 DDC+ AZT 56
3 DDI 39
4 RTV+ D4T+ 3TC 30
5 IDV+ D4T+ 3TC 34
6 None 124
7 NFV+ AZT+ 3TC 32
8 EFV+ AZT+ 3TC 17
9 TDF+ LPV+ DDI+ 3TC 42

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   K20R, M36I, R41K, D60E, I62V, L63P, A71V, I93L  
>CA24634| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFVKVRQYE
QVPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215F   G190Q   V35VL, K43Q, V118I, K122P, V189I, R211EG, L228R, A272P, P294T, E297K  
>CA24633| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYIQSDLEIGQHRTKIEELRQHLWEWGFFTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVITLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003