<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MK169 MK169w26 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A V108I V8VI, K103R, K166R, K173KR, Q174HR, I178IM, G196E, L210S, V245E, A272P, K277R, P294T  
>MK169w26| codons 1-302
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKRKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRRRNPDMVI
YQYVDDLYVASDLEIEQHRTKIEELRQHLSRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVITLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, P39T, I62IV, L63LP, I64IV, V77I  
>MK169w26| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEMNLTGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Mollan, K HIV-1 amino acid changes among participants with virologic failure: associations with first-line efavirenz or atazanavir plus ritonavir and disease status. J Infect Dis, 2012