<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MK129 MK129w24 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KE, M184V   K101E, Y181C, G190A V108VI, P225H K32E, V60I, S68G, K122E, D123N, I135R, Q174R, I178L, V189VI, R211K, H221Y, P243H, V245E, D250E, A272P, K277R, I293V, E312Q I329IM
>MK129w24| codons 1-329
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIEALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDLVI
CQYVDDLYIASDLEIGQHRTKIEELRQHLLKWGFTTPDKKYQKEHPFLWMGYELHPDKWT
VQHIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKQPVHGVYYDPSKDLIAEM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, R41K, L63LP  
>MK129w24| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Mollan, K HIV-1 amino acid changes among participants with virologic failure: associations with first-line efavirenz or atazanavir plus ritonavir and disease status. J Infect Dis, 2012
Rhee, SY Mutational Correlates of Virological Failure in Individuals Receiving a WHO-Recommended Tenofovir-Containing First-Line Regimen: An International Collaboration. EBioMedicine, 2017