<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+ATV+RTV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, M36I, N37D, L63Q, H69Q, Q92K  
>MK112w35| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIQIEICGQKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V108VI A98S, D123N, S162Y, D177E, V179VI, Q197E, D250E, K277R, P294T, E297K, E300EK  
>MK112w35| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTILDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEIII
YQYMDDLYVGSDLEIGEHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVITLTKEAK
L

References
Author Title Citation
Mollan, K HIV-1 amino acid changes among participants with virologic failure: associations with first-line efavirenz or atazanavir plus ritonavir and disease status. J Infect Dis, 2012