<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9943 CA24596 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+D4T+IDV 114

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L76V   E35D, M36I, N37D, I62V, L63P, H69R, I93L  
>CA24596| codons 1-98
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGRKAIGTVVVGPTPVNIIGRNLLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       E36D, T39D, I135T, S162Y, T200K, R211K, A288S, I293V  
>CA24595| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVDICDELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRKKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005