<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5016 CA24593 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 DDI 22
3 D4T+IDV 30
4 3TC+DDI+NFV 48
5 D4T+DDI+NVP 84
6 3TC+AZT+DDI+EFV 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   K101KE, K103KN, Y181C, G190A V108I E6D, I31IL, A98S, K102Q, K122E, I135V, S162T, E169D, T200I, T215X, H221Y, D237E, K277R, T286A, E291D, E297A  
>CA24593| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLEQNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQTSMTKILDPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRIKIEELRQHLLRWGFXTPDKKYQKEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDVIPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   M36I, R57K, I62V, L63S, A71V, I93L  
>CA24594| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QVSIEICGHKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005