<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2105 CA24588 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 70
2 D4T 22
3 AZT 11
4 3TC+AZT 12
5 3TC+AZT+IDV 50
6 D4T+DDI+NFV 58
7 D4T+DLV+NFV 34
8 D4T+RTV+SQV 55
9 APV+D4T+SQV 86

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, V82VA, I84IV, L90M   T12S, L19I, L24LF, R57K, L63P, A71I, V77I, I93L  
>CA24588| codons 1-99
PQITLWQRPLVSIKIGGQIKEALFDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVKQYD
QIPIEICGHKIIGTVLIGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215F   K103N   V35L, T39K, K43E, I135L, S162C, R211K, A272S, I293V  
>CA24587| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICKELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005