<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, P9S, V35T, K122E, D123S, S162C, K173R, Q174K, D177E, Q207A, L210M, R211N, V245E, T286A, E291D, V292I, I293V  
>10MYKJ067| codons 1-297
PISPIDTVSVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLMNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14E, G16E, E35D, M36I, N37D, I62V, E65K, H69K, L89M  
>10MYKJ067| codons 1-99
PQITLWQRPLVTIEIEGQLKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVLIKICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Chow, WZ Molecular diversity of HIV-1 among people who inject drugs in Kuala Lumpur, Malaysia: massive expansion of circulating recombinant form (CRF) 33_01B and emergence of multiple unique recombinant clusters. PLoS ONE, 2013