<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9940 CA24582 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 D4T 52
3 3TC+D4T 65
4 3TC+D4T+NFV 143
5 3TC+ABC+NFV 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, D60E, L63P, A71T, V77I, I93L G49GE
>CA24582| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGEIGGFIKVRQYE
QIPIEICGHKTIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KE, M184V V75VI     V35I, A158S, S162SC, Q207E, R211RK, F214L, V245IK, T286TA, K287KR, I293V, G359S, V381I, A400T, T403I, L452LI, R461K, V467VI, L469I, H483HY, L491S, S519N, E529ED, V531I, Q547K, K558R E300E_E
>CA24581| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTEWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGARALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATESIIIWGKTPKFKLPIQKETWETWWIEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKIGKAGYVTDKGRQKVISITDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKDKIYLAWVPAHK
GIGGNEKVDKLVSAGIRRVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005