<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA794 CA24578 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 DDI 43
3 DDC 13
4 D4T 30
5 AZT+D4T 18
6 3TC+AZT+IDV 52
7 D4T+DDI+NVP 19
8 3TC+D4T+RTV+SQV 58
9 3TC+DDI+EFV+RTV+SQV 17
10 3TC+RTV+SQV 45
11 None 34
12 ABC+DDI+LPV 11
13 ABC+APV+DDI+LPV 17
14 ABC+DDI+LPV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L10F, L33F, K43T K20R, E35D, M36V, N37D, D60E, I62V, L63P, A71V, I93L  
>CA24578| codons 1-98
PQITLWQRPFVTIKIGGQLREALLDTGADDTVFEDVDLPGRWTPKLIGGIGGFVKVRQYE
QVPIEICGHKVIGTVLVGPTPANVIGRNLMTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Q151M, L210W, T215Y A62V, V75I, F116Y Y181I   K20R, V21I, V35I, K43Q, S68N, E79D, R83K, K122E, G196E, Q197K, F214L, K223Q, A272P, K277R  
>CA24577| codons 1-299
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FVIKRKNNTKWRKLIDFRDLNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
IQYMDDLYVGSDLEIEKHRTKIEELRQHLWRWGLYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEA

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005