<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9937 CA24567 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 9
2 3TC+AZT+IDV 134

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y A62V     T7A, T39A, E44ED, R83K, D121H, K122E, K166R, D177E, I180IV, G196E, T200A, R211K, K277R, K281R, T286A, A288S, I293IV, E297K  
>CA24567| codons 1-299
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVV
YQYVDDLYVGSDLEIEQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCRLLRGAKSLTEVVPLTKEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   I13V, N37T, I62V, L63P, I64IL, V77I, I93L  
>CA24568| codons 1-98
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKIIGGIGGFIKVRQYD
QVPLEICGHKAIGTVLIGPTPVNIIGRSLLTQLGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005