<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9933 CA24557 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 160

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M V75I, F77L, F116Y   V108VI K20R, V35I, E79ED, R83K, V118I, E203D, F214L, T286A, A288T, E297K, K311KR, S322T, I329L, A376T, K390R, A400T, A437V, E449D, H483HN, K530R, A554S  
>CA24557| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLIDLRDLNKKTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYYSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKTLTEVIPLTKEAE
LELAENREILREPVHGVYYDPTKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGVETFYVDGAANRDTKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, E35D, N37S, R57K, I62V, L63P  
>CA24558| codons 1-98
PQITLWQRPLVSIKVGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005