<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
hnsy5 hnsy5 China 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10D, A91T, L101I, S119R, T122A, T124N, T125S, G149A, K156N, K211R, N222H, I257T L68M
>hnsy5| codons 1-288
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHMEGKIILVAVHVASGYIEAEVIPTETGQETAYFILKLAGRWPVKTIHTDNGRN
FASNSVKAACWWAGIKQEFGIPYNPQSQAVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTRELQKQITKIQHFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDTKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33*, E34K, E35D, M36I, D60N, L63P, I72V, L76*, V77I, I93L  
>hnsy5| codons 6-99
WQRPLVTIKIGGQLKEALLDTGADDTV*KDINLPGRWKPKMIGGIGGFIKVRQYNQIPIE
ICGHKAVGTV*IGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Li, L Relatively high prevalence of drug resistance among antiretroviral-naive patients from Henan, central China. ARHR, 2013