<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1579 CA24548 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 134
2 3TC+AZT 63
3 D4T+DDI+IDV 16
4 3TC+AZT+IDV 16
5 D4T+DLV+RTV+SQV 53
6 3TC+D4T+DDI+NFV+NVP 55
7 APV+D4T+DDI+NVP 16
8 APV+D4T+DDI+RTV 72

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, I84V   L10I, N37D, L63P, H69Y, A71V, V77I, I85IV, I93L  
>CA24548| codons 1-98
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIVGIGGFVKVRQYD
QIPIEICGYKVIGTVLIGPTPANVVGRNLLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   M230L F227L K20R, K122E, E138G, D177E, I178L, R211K, H221Y, V245M, I293V  
>CA24547| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKYQKEPPLLWLGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005