<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1317 CA24539 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 3TC+ AZT+ DDI NA
3 None 3
4 D4T+ DDI+ IDV 53
5 3TC+ AZT+ SQV 37
6 None 6
7 D4T+ IDV+ NVP+ RTV 16
8 3TC+ ABC+ AZT+ LPV+ SQV 57

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, V75I, F77L, F116Y Y181C   E40K, K43KE, K46Q, K49R, I50V, T58N, S68G, K122E, P170S, Q174K, T200A, Q207E, R211K, K219T, V245T, E248D, D250E, S251D, A272P, K277R, T286A, A288S, V292I, E297K S3SN
>CA24539| codons 1-300
PINPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTKMEEEGQISRVGPENPYNNPV
FVIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILESFRKKNPDIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDTKHQKEPPFLWMGYELHPDKWT
VQPITLPDKEDWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTEIIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L90M L10F, N88G I13IL, I15V, K20T, E35D, M36I, N37ND, R41K, R57K, I62V, L63P, C67Y, A71V, T74S, I93L  
>CA24540| codons 1-99
PQITLWQRPFVTLKVGGQLTEALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFVKVKQYD
QVPIEIYGHKVIGSVLVGPTPVNIIGRGLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005