<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1551 CA24538 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 DDI 65
3 D4T 100
4 3TC+D4T+IDV 104
5 3TC+DDC+NFV 26
6 3TC+NFV+NVP 35
7 ABC+DDI+RTV+SQV 153

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82AT, L90LM F53L L10LI, K20R, E35D, M36I, N37S, L63P, A71V  
>CA24538| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDISLPGRWKPKMIGGIGGLVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, L210LW, T215Y   K103N   K20R, T39A, K102KR, K122E, I135T, R211RK, A272P, I293V  
>CA24537| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009