<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1548 CA24513 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 AZT+ DDC 108
3 DDI 95
4 D4T 30
5 3TC+ AZT 39
6 3TC+ AZT+ IDV 21
7 3TC+ D4T+ IDV 12
8 3TC+ D4T+ NFV+ NVP 21
9 3TC+ D4T+ NFV+ SQV 39
10 D4T+DDI+NFV+SQV 148
11 None 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, T215Y K219KE     K20R, T39TA, V60VI, K104N, D123E, S162C, I178M, V179I, T200A, E203ED, L228LH, A272T, I293IV  
>CA24513| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMII
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLRWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, L63P, I64V  
>CA24514| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005