<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1585 CA24509 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 22
2 3TC+AZT 26
3 3TC+D4T 48
4 DDI+DLV+NFV+SQV 30
5 3TC+DDI+DLV+EFV+IDV+NFV+SQV 9
6 3TC+EFV+IDV+NFV 70
7 3TC+ABC+NFV+NVP+RTV 26
8 3TC+ABC+APV+NVP+RTV 52
9 3TC+ABC+LPV 31
10 3TC+ABC+LPV+TDF 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K101E   V35IT, T39TA, S68G, K102KQ, D123E, I135K, D177E, V245M, T286A, E297K  
>CA24509| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, G16E, E35D, M36I, N37NS, R57K, L63A, I93L  
>CA24510| codons 1-99
PQITLWQRPIVTIKIEGQLKEALLDTGADDTVLEDISLPGRWKPKMIGGIGGFIKVKQYD
QIAIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005