<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1125 CA24503 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 208
2 DDC 52
3 DDI 91
4 AZT+ 3TC 52
5 RTV+ DDC+ D4T 8
6 IDV+ DDC+ D4T 12
7 None 29
8 IDV+ AZT+ 3TC 21
9 AZT+ 3TC+ SQV 90
10 3TC+AZT+SQV 36
11 3TC+ABC+APV+EFV+LPV 39
12 3TC+EFV+T20+TDF 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     T39A, V60I, A98S, K101I, D123E, S162Y, D177N, V179I, G196E, Q207E, D218E, L228H, V245E, A272P, K277R, A288S, E291D, I293V, E297T  
>CA24503| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLIKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPNIII
YQYVDDLYVGSDLEIEQHRTKIEELREHLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTDVVPLTTEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M   L10LI, I13V, K14KR, K20I, E35D, M36I, R41K, D60E, I62IV, L63P, A71V, P79PS  
>CA24504| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFLKVRQYE
QVPIEICGHKVIGTVLVGSTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005