<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5056 CA24482 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 117
2 3TC+AZT 74
3 D4T+DDI+NFV 78
4 EFV+RTV+SQV 92
5 None 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, N88NS, L90M   L10LV, R41K, F53Y, Q61H, L63P, K70R, T74TS, V77I, I93IL  
>CA24482| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGYLKVRQYD
HIPIEICGHRAIGSVLIGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, L210W D67G, T215CS L100I, K103N   T39A, E44D, S68G, K102R, K122E, I142V, V179I, G196E, R211A, D237E, I293V  
>CA24481| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKDGKISKIGPENPYNTPV
FAIKKKGGDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWAWGFCTPDKKHQKEPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005