<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5199 CA24480 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 AZT+DDI 21
3 3TC+AZT+IDV 228
4 D4T+DDI+EFV 20
5 3TC+DDI+DLV+IDV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M Q58E L10I, L19Q, L63P, H69R, I93L, C95F  
>CA24480| codons 1-98
PQITLWQRPIVTIKIGGQQKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVREYD
QIPIEICGRKAIGTVLVGPTPANIIGRNLMTQLGFTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, T215Y F116Y G190EQ   V35M, K122E, V179G, T200TI, V245E, V276VI, A288S, E297A  
>CA24479| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIGI
YQYMDDLYVQSDLEIGQHRIKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGTKSLTEVIPLTAEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005