<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9909 CA24471 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 13
2 3TC+DDI 70
3 3TC+D4T+NVP 215

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   Y181C   I31L, T39A, A98S, K122E, I135R, S162C, T200TA, Q207E, H221Y, V245E, A272P, T286A, I293V  
>CA24471| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFFTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I15V, L19Q, A71T, I72T, V77I, I93L  
>CA24472| codons 1-99
PQITLWQRPLVPIKVGGQQKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKTTGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005