<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9908 CA24469 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 100
2 3TC+AZT 39
3 DDI+NVP+TDF 243

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V60I, R83K, V90I, D123E, S162Y, N175Y, T200A, K201I, L228H, K277R, A288S, I293V, E297A  
>CA24469| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQYPDIVI
YQYVDDLYVGSDLEIGQHRAIIEELRQHLLRWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, K14R, L19I, L63P, I64V, A71T, I93L  
>CA24470| codons 1-98
PQITLWQRPIVTIRIGGQIKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPANIIGRNLLTQLGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005