<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9902 CA24449 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 69
2 3TC+D4T+EFV 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Q151M, M184V D67G, K70H, K219R K101E, Y181C, G190AS   K82R, I142V, S162AD, R211K, A272P, K277R K30R
>CA24449| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEERIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSTHWRKVVDFRELNRRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, N37S, P39PQ, L63P  
>CA24450| codons 15-99
IGGQIKEALLDTGADDTVLEEMSLQGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGT
VLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005