<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6475 CA24428 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 135
2 3TC+AZT+NFV 65
3 APV+D4T+EFV 79

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L90M L33F, G73S I13V, E35D, M36I, N37T, I62V, L63P, A71V, I72L  
>CA24428| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVFEDITLPGRWKPKMIGGIGGFLKVRQYD
QVPIEICGHKVLSTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V   K103N   T69N, A98S, I135L, I142T, T200V, R211K, A272S, A288T, V292I, E297A  
>CA24427| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRVKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKTLTEIIPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005