<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
X12052 X12052 Hong Kong 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11A, V35T, T39K, K43E, K102KR, K122E, D123N, I135T, S162ST, K166KR, K173IM, Q174K, D177E, G196E, I202V, Q207A, L210M, R211S, V245E, I274IV, I293V, E312T, I326V, I329V, G335D, R356K, M357K, R358RG, G359S, K366R, A371V, I375IV, T386I, K390R, K395R, A400T L303LF, E399GV
>X12052| codons 1-401
PISPIDTVPVALKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQTSMTRILEPFRMKNPEIVI
YQYMDDLYVGSDLEIEQHRTKVEELRAHLMSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGVKVKQLCKLLRGTKALTEVVPLTEEAE
LEFAENREILKTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYAKKGSA
HTNDVRQLTEVVQKVATESIVIWGKIPKFRLPIQRETWVTW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, R41K, H69K, I72IATV, L89M  
>X12052| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kiertiburanakul, S Comparisons of primary HIV-1 drug resistance between recent and chronic HIV-1 infection within a sub-regional cohort of Asian patients. PLoS ONE, 2013