<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9880 CA24381 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA
2 Unknown 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_ST, M184V, T215Y A62AV K101P, K103N   K43Q, V118I, K122E, S162D, K166R, D177N, V179I, T200A, Q207E, L210F, R211K, V245E, A272P, K277R, E291D, I293V  
>CA24381| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FVIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPNIII
YQYVDDLYVGSDLEIGQHRAKIEELREHLFKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, N37S, R41K, K55KR, I62V, L63C, V77I  
>CA24382| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIRVRQYD
QVCIEICGHKAIGTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012